SCOP 1.71: Domain d1hjuc_: 1hju C:

Lineage for d1hjuc_ (1hju C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (13 families)

5. Family c.1.8.3: beta-glycanases [51487] (22 proteins)
   consist of a number of sequence families

6. Protein Beta-1,4-galactanase [89469] (4 species)

7. Species Myceliophthora thermophila (Thielavia heterothallica) [TaxId:78579] [89471] (2 PDB entries)
   Myceliophthora thermophila is the anamorph name whilst Thielavia heterothallica is the teleomorph name

8. Domain d1hjuc_: 1hju C: [83498]

Details for d1hjuc_

PDB Entry: 1hju, 2.15 Å

PDB Description: structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.

SCOP Domain Sequences for d1hjuc_:

Sequence; same for both SEQRES and ATOM records:

>d1hjuc_ c.1.8.3 (C:) Beta-1,4-galactanase {Myceliophthora thermophila (Thielavia heterothallica)}
altyrgvdwssvvveeragvsykntngnaqplenilaangvntvrqrvwvnpadgnynld
yniaiakrakaaglgvyidfhysdtwadpahqtmpagwpsdidnlswklynytldaankl
qnagiqptivsigneiragllwptgrtenwaniarllhsaawgikdsslspkpkimihld
ngwdwgtqnwwytnvlkqgtlelsdfdmmgvsfypfysssatlsalkssldnmaktwnke
iavvetnwpiscpnprysfpsdvknipfspegqttfitnvanivssvsrgvglfywepaw
ihnanlgsscadntmfsqsgqalsslsvfqri

Timeline for d1hjuc_:

• d1hjuc_ first appeared in SCOP 1.65
  
• d1hjuc_ appears in SCOP 1.69
  
• d1hjuc_ appears in SCOP 1.73
  
• d1hjuc_ appears in the current release, SCOPe 2.08