Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Beta-1,4-galactanase [89469] (4 species) |
Species Thielavia heterothallica, aka Myceliophthora thermophila [TaxId:78579] [89471] (2 PDB entries) Myceliophthora thermophila is the anamorph name whilst Thielavia heterothallica is the teleomorph name |
Domain d1hjsa_: 1hjs A: [83492] complexed with epe, nag, peg, so4 |
PDB Entry: 1hjs (more details), 1.87 Å
SCOPe Domain Sequences for d1hjsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} altyrgvdwssvvveeragvsykntngnaqplenilaangvntvrqrvwvnpadgnynld yniaiakrakaaglgvyidfhysdtwadpahqtmpagwpsdidnlswklynytldaankl qnagiqptivsigneiragllwptgrtenwaniarllhsaawgikdsslspkpkimihld ngwdwgtqnwwytnvlkqgtlelsdfdmmgvsfypfysssatlsalkssldnmaktwnke iavvetnwpiscpnprysfpsdvknipfspegqttfitnvanivssvsrgvglfywepaw ihnanlgsscadntmfsqsgqalsslsvfqri
Timeline for d1hjsa_: