Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins) |
Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species) |
Species Archaeon Thermococcus celer [TaxId:2264] [89986] (3 PDB entries) |
Domain d1h7ma_: 1h7m A: [83485] |
PDB Entry: 1h7m (more details), 1.96 Å
SCOP Domain Sequences for d1h7ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7ma_ d.79.3.1 (A:) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer} gsvdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgi pvyefegtsvelgtllgrphtvsalavvdpgesrilalg
Timeline for d1h7ma_: