Lineage for d1h5oa_ (1h5o A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 428702Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 428703Superfamily g.9.1: Defensin-like [57392] (2 families) (S)
  5. 428778Family g.9.1.2: Myotoxin [90157] (1 protein)
    structurally similar to beta-defensin
  6. 428779Protein Crotamine [90158] (1 species)
  7. 428780Species South american rattlesnake (Crotalus durissus terrificus) [TaxId:8732] [90159] (1 PDB entry)
  8. 428781Domain d1h5oa_: 1h5o A: [83484]

Details for d1h5oa_

PDB Entry: 1h5o (more details)

PDB Description: Solution structure of Crotamine, a neurotoxin from Crotalus durissus terrificus

SCOP Domain Sequences for d1h5oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5oa_ g.9.1.2 (A:) Crotamine {South american rattlesnake (Crotalus durissus terrificus)}
ykqchkkgghcfpkekiclppssdfgkmdcrwrwkcckkgsg

SCOP Domain Coordinates for d1h5oa_:

Click to download the PDB-style file with coordinates for d1h5oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h5oa_: