Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) |
Family c.68.1.8: Molybdenum cofactor biosynthesis protein MobA [53470] (1 protein) |
Protein Molybdenum cofactor biosynthesis protein MobA [53471] (1 species) |
Species Escherichia coli [TaxId:562] [53472] (8 PDB entries) |
Domain d1h4ea_: 1h4e A: [83483] complexed with cit, li; mutant |
PDB Entry: 1h4e (more details), 1.65 Å
SCOP Domain Sequences for d1h4ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4ea_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli} mttitgvvlaggkarrmggvdkgllelngkplwqhvadalmtqlshvvvnanrhqeiyqa sglkviedsladypgplagmlsvmqqeagewflfcpcntpyippdlaarlnhqrkdapvv wvhdgerdhptialvnraiepllleylqagerrvmvfmrlagghavdfsdhkdafvnvnt peelarwq
Timeline for d1h4ea_: