Lineage for d1h4ea_ (1h4e A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 319172Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 319173Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 319347Family c.68.1.8: Molybdenum cofactor biosynthesis protein MobA [53470] (1 protein)
  6. 319348Protein Molybdenum cofactor biosynthesis protein MobA [53471] (1 species)
  7. 319349Species Escherichia coli [TaxId:562] [53472] (8 PDB entries)
  8. 319352Domain d1h4ea_: 1h4e A: [83483]
    complexed with cit, li; mutant

Details for d1h4ea_

PDB Entry: 1h4e (more details), 1.65 Å

PDB Description: biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba

SCOP Domain Sequences for d1h4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4ea_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli}
mttitgvvlaggkarrmggvdkgllelngkplwqhvadalmtqlshvvvnanrhqeiyqa
sglkviedsladypgplagmlsvmqqeagewflfcpcntpyippdlaarlnhqrkdapvv
wvhdgerdhptialvnraiepllleylqagerrvmvfmrlagghavdfsdhkdafvnvnt
peelarwq

SCOP Domain Coordinates for d1h4ea_:

Click to download the PDB-style file with coordinates for d1h4ea_.
(The format of our PDB-style files is described here.)

Timeline for d1h4ea_: