SCOPe 2.05: Domain d1h46x_: 1h46 X:

Lineage for d1h46x_ (1h46 X:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)

7. Species Basidomycetes fungus (Phanerochaete chrysosporium), Cel7d [TaxId:5306] [69239] (2 PDB entries)

8. Domain d1h46x_: 1h46 X: [83476]
   complexed with nag, rnp

Details for d1h46x_

PDB Entry: 1h46, 1.52 Å

PDB Description: the catalytic module of cel7d from phanerochaete chrysosporium as a chiral selector: structural studies of its complex with the b-blocker (r)-propranolol

PDB Compounds: (X:) exoglucanase I

SCOPe Domain Sequences for d1h46x_:

Sequence; same for both SEQRES and ATOM records:

>d1h46x_ b.29.1.10 (X:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Basidomycetes fungus (Phanerochaete chrysosporium), Cel7d [TaxId: 5306]}
eqagtntaenhpqlqsqqcttsggckplstkvvldsnwrwvhstsgytncytgnewdtsl
cpdgktcaancaldgadysgtygitstgtaltlkfvtgsnvgsrvylmaddthyqllkll
nqeftfdvdmsnlpcglngalylsamdadggmskypgnkagakygtgycdsqcpkdikfi
ngeanvgnwtetgsntgtgsygtccsemdiweanndaaaftphpctttgqtrcsgddcar
ntglcdgdgcdfnsfrmgdktflgkgmtvdtskpftvvtqfltndntstgtlseirriyi
qngkviqnsvanipgvdpvnsitdnfcaqqktafgdtnwfaqkgglkqmgealgngmvla
lsiwddhaanmlwldsdyptdkdpsapgvargtcattsgvpsdvesqvpnsqvvfsnikf
gdigstfsgts

Timeline for d1h46x_:

• d1h46x_ first appeared in SCOP 1.65
  
• d1h46x_ appears in SCOPe 2.04
  
• d1h46x_ appears in SCOPe 2.06
  
• d1h46x_ appears in the current release, SCOPe 2.08