Lineage for d1h41b2 (1h41 B:5-151)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729626Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 729664Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
  6. 729665Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
    inverting reaction mechanism
  7. 729674Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries)
  8. 729678Domain d1h41b2: 1h41 B:5-151 [83475]
    Other proteins in same PDB: d1h41a1, d1h41b1
    complexed with co, edo, gcv; mutant

Details for d1h41b2

PDB Entry: 1h41 (more details), 1.5 Å

PDB Description: pseudomonas cellulosa e292a alpha-d-glucuronidase mutant complexed with aldotriuronic acid
PDB Compounds: (B:) alpha-glucuronidase

SCOP Domain Sequences for d1h41b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h41b2 d.92.2.2 (B:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa [TaxId: 155077]}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr

SCOP Domain Coordinates for d1h41b2:

Click to download the PDB-style file with coordinates for d1h41b2.
(The format of our PDB-style files is described here.)

Timeline for d1h41b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h41b1