| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) ![]() contains similar fold but lacks its catalytic centre |
| Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein) family GH67 |
| Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species) inverting reaction mechanism |
| Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries) |
| Domain d1h41b2: 1h41 B:5-151 [83475] Other proteins in same PDB: d1h41a1, d1h41b1 |
PDB Entry: 1h41 (more details), 1.5 Å
SCOP Domain Sequences for d1h41b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h41b2 d.92.2.2 (B:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr
Timeline for d1h41b2: