SCOP 1.65: Domain d1h41b2: 1h41 B:5-151

Lineage for d1h41b2 (1h41 B:5-151)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
   family GH67

6. Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
   inverting reaction mechanism

7. Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries)

8. Domain d1h41b2: 1h41 B:5-151 [83475]
   Other proteins in same PDB: d1h41a1, d1h41b1
   complexed with co, edo, gcv; mutant

Details for d1h41b2

PDB Entry: 1h41, 1.5 Å

PDB Description: pseudomonas cellulosa e292a alpha-d-glucuronidase mutant complexed with aldotriuronic acid

SCOP Domain Sequences for d1h41b2:

Sequence; same for both SEQRES and ATOM records:

>d1h41b2 d.92.2.2 (B:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr

Timeline for d1h41b2:

• d1h41b2 is new in SCOP 1.65
  
• d1h41b2 appears in SCOP 1.67
  
• d1h41b2 appears in the current release, SCOPe 2.08