Lineage for d1h41a1 (1h41 A:152-712)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083545Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 protein domains)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2083546Protein alpha-D-glucuronidase catalytic domain [82254] (2 species)
    inverting reaction mechanism
  7. 2083555Species Pseudomonas cellulosa [TaxId:155077] [82255] (5 PDB entries)
  8. 2083556Domain d1h41a1: 1h41 A:152-712 [83472]
    Other proteins in same PDB: d1h41a2, d1h41b2
    complexed with co, edo, gcv; mutant

Details for d1h41a1

PDB Entry: 1h41 (more details), 1.5 Å

PDB Description: pseudomonas cellulosa e292a alpha-d-glucuronidase mutant complexed with aldotriuronic acid
PDB Compounds: (A:) alpha-glucuronidase

SCOPe Domain Sequences for d1h41a1:

Sequence, based on SEQRES records: (download)

>d1h41a1 c.1.8.10 (A:152-712) alpha-D-glucuronidase catalytic domain {Pseudomonas cellulosa [TaxId: 155077]}
lqhrvvnhwdnlnrvvergyaglslwdwgslpnylaprytdyarinaslgingtvinnvn
adprvlsdqflqkiaaladafrpygikmylsinfnsprafgdvdtadpldprvqqwwktr
aqkiysyipdfggflvkadsagqpgpqgygrdhaeganmlaaalkpfggvvfwrafvyhp
diedrfrgaydefmpldgkfadnvilqikngpidfqprepfsalfagmsrtnmmmefqit
qeyfgfathlayqgplfeeslktethargegstignilegkvfktrhtgmagvinpgtdr
nwtghpfvqsswyafgrmawdhqisaataadewlrmtfsnqpafiepvkqmmlvsreagv
nyrsplglthlysqgdhygpapwtddlpradwtavyyhrasktgigfnrtktgsnalaqy
pepiakawgdlnsvpedlilwfhhlswdhrmqsgrnlwqelvhkyyqgveqvramqrtwd
qqeayvdaarfaqvkallqvqereavrwrnscvlyfqsvagrpipanyeqpehdleyykm
larttyvpepwhpasssrvlk

Sequence, based on observed residues (ATOM records): (download)

>d1h41a1 c.1.8.10 (A:152-712) alpha-D-glucuronidase catalytic domain {Pseudomonas cellulosa [TaxId: 155077]}
lqhrvvnhwdnlnrvvergyaglslwdwgslpnylaprytdyarinaslgingtvinnvn
adprvlsdqflqkiaaladafrpygikmylsinfnsprafgdvdtadpldprvqqwwktr
aqkiysyipdfggflvkadsagqpgpqgygrdhaeganmlaaalkpfggvvfwradrfrg
aydefmpldgkfadnvilqikngpidfqprepfsalfagmsrtnmmmefqitqeyfgfat
hlayqgplfeeslktethargegstignilegkvfktrhtgmagvinpgtdrnwtghpfv
qsswyafgrmawdhqisaataadewlrmtfsnqpafiepvkqmmlvsreagvnyrsplgl
thlysqgdhygpapwtddlpradwtavyyhrasktgigfnrtktgsnalaqypepiakaw
gdlnsvpedlilwfhhlswdhrmqsgrnlwqelvhkyyqgveqvramqrtwdqqeayvda
arfaqvkallqvqereavrwrnscvlyfqsvagrpipanyeqpehdleyykmlarttyvp
epwhpasssrvlk

SCOPe Domain Coordinates for d1h41a1:

Click to download the PDB-style file with coordinates for d1h41a1.
(The format of our PDB-style files is described here.)

Timeline for d1h41a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h41a2