SCOPe 2.07: Domain d1h3za_: 1h3z A:

Lineage for d1h3za_ (1h3z A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
   includes the C-terminal all-alpha subdomain

6. Protein Hypothetical protein SPBC215.07c [89297] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [89298] (1 PDB entry)

8. Domain d1h3za_: 1h3z A: [83471]

Details for d1h3za_

PDB Entry: 1h3z

PDB Description: solution structure of a pwwp domain from schizosaccharomyces pombe

PDB Compounds: (A:) hypothetical 62.8 kda protein c215.07c

SCOPe Domain Sequences for d1h3za_:

Sequence; same for both SEQRES and ATOM records:

>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
servnykpgmrvltkmsgfpwwpsmvvteskmtsvarkskpkragtfypviffpnkeylw
tgsdsltpltseaisqflekpkpktaslikaykmaqstpdldslsvps

Timeline for d1h3za_:

• d1h3za_ first appeared in SCOP 1.65
  
• d1h3za_ appears in SCOPe 2.06
  
• d1h3za_ appears in the current release, SCOPe 2.08