Class b: All beta proteins [48724] (180 folds) |
Fold b.31: EV matrix protein [50011] (1 superfamily) consists of two beta-sandwich domains of similar topologies |
Superfamily b.31.1: EV matrix protein [50012] (2 families) |
Family b.31.1.1: EV matrix protein [50013] (2 proteins) |
Protein EV matrix protein [50014] (1 species) |
Species Ebola virus [TaxId:205488] [50015] (3 PDB entries) |
Domain d1h2db_: 1h2d B: [83464] N-terminal domain in complex with RNA protein/RNA complex; complexed with cl |
PDB Entry: 1h2d (more details), 2.6 Å
SCOPe Domain Sequences for d1h2db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2db_ b.31.1.1 (B:) EV matrix protein {Ebola virus [TaxId: 205488]} vssafileamvnvisgpkvlmkqipiwlplgvadqktysfdsttaaimlasytithfgka tnplvrvnrlgpgipdhplrllrignqaflqefvlppvqlpqyftfdltalklitqplpa atwt
Timeline for d1h2db_: