Lineage for d1h2db_ (1h2d B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782271Fold b.31: EV matrix protein [50011] (1 superfamily)
    consists of two beta-sandwich domains of similar topologies
  4. 2782272Superfamily b.31.1: EV matrix protein [50012] (2 families) (S)
  5. 2782273Family b.31.1.1: EV matrix protein [50013] (2 proteins)
  6. 2782274Protein EV matrix protein [50014] (1 species)
  7. 2782275Species Ebola virus [TaxId:205488] [50015] (3 PDB entries)
  8. 2782280Domain d1h2db_: 1h2d B: [83464]
    N-terminal domain in complex with RNA
    protein/RNA complex; complexed with cl

Details for d1h2db_

PDB Entry: 1h2d (more details), 2.6 Å

PDB Description: ebola virus matrix protein vp40 n-terminal domain in complex with rna (low-resolution vp40[31-212] variant).
PDB Compounds: (B:) matrix protein vp40

SCOPe Domain Sequences for d1h2db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2db_ b.31.1.1 (B:) EV matrix protein {Ebola virus [TaxId: 205488]}
vssafileamvnvisgpkvlmkqipiwlplgvadqktysfdsttaaimlasytithfgka
tnplvrvnrlgpgipdhplrllrignqaflqefvlppvqlpqyftfdltalklitqplpa
atwt

SCOPe Domain Coordinates for d1h2db_:

Click to download the PDB-style file with coordinates for d1h2db_.
(The format of our PDB-style files is described here.)

Timeline for d1h2db_: