SCOPe 2.06: Domain d1h1tb_: 1h1t B:

Lineage for d1h1tb_ (1h1t B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Phosphopantetheine adenylyltransferase [52398] (6 species)

7. Species Escherichia coli [TaxId:562] [52399] (4 PDB entries)

8. Domain d1h1tb_: 1h1t B: [83459]
   complexed with coa, pns, so4

Details for d1h1tb_

PDB Entry: 1h1t, 1.78 Å

PDB Description: phosphopantetheine adenylyltransferase in complex with coenzyme a from escherichia coli

PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d1h1tb_:

Sequence; same for both SEQRES and ATOM records:

>d1h1tb_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla

Timeline for d1h1tb_:

• d1h1tb_ first appeared in SCOP 1.65
  
• d1h1tb_ appears in SCOPe 2.05
  
• d1h1tb_ appears in SCOPe 2.07
  
• d1h1tb_ appears in the current release, SCOPe 2.08