Lineage for d1h1tb_ (1h1t B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) Protein Phosphopantetheine adenylyltransferase [52398] (7 species) 
Species Escherichia coli [TaxId:562] [52399] (10 PDB entries) 
Domain d1h1tb_: 1h1t B: [83459]
complexed with coa, pns, so4
Details for d1h1tb_
PDB Entry: 1h1t (more details), 1.78 Å
PDB Description: phosphopantetheine adenylyltransferase in complex with coenzyme a from escherichia coli
PDB Compounds: (B:) phosphopantetheine adenylyltransferaseSCOPe Domain Sequences for d1h1tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1tb_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla
SCOPe Domain Coordinates for d1h1tb_:
Click to download the PDB-style file with coordinates for d1h1tb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h1tb_:
- d1h1tb_ first appeared in SCOP 1.65
- d1h1tb_ appears in SCOPe 2.07
View in 3D
