Lineage for d1h1ta_ (1h1t A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119196Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2119314Protein Phosphopantetheine adenylyltransferase [52398] (6 species)
  7. 2119317Species Escherichia coli [TaxId:562] [52399] (4 PDB entries)
  8. 2119322Domain d1h1ta_: 1h1t A: [83458]
    complexed with coa, pns, so4

Details for d1h1ta_

PDB Entry: 1h1t (more details), 1.78 Å

PDB Description: phosphopantetheine adenylyltransferase in complex with coenzyme a from escherichia coli
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d1h1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1ta_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
kewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d1h1ta_:

Click to download the PDB-style file with coordinates for d1h1ta_.
(The format of our PDB-style files is described here.)

Timeline for d1h1ta_: