Lineage for d1h1ta_ (1h1t A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312145Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 312146Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 312272Family c.26.1.3: Adenylyltransferase [52397] (4 proteins)
  6. 312346Protein Phosphopantetheine adenylyltransferase [52398] (2 species)
  7. 312347Species Escherichia coli [TaxId:562] [52399] (4 PDB entries)
  8. 312352Domain d1h1ta_: 1h1t A: [83458]

Details for d1h1ta_

PDB Entry: 1h1t (more details), 1.78 Å

PDB Description: phosphopantetheine adenylyltransferase in complex with coenzyme a from escherichia coli
PDB Compounds: (A:)

SCOP Domain Sequences for d1h1ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1ta_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli}
qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
kewsfissslvkevarhqgdvthflpenvhqalmakla

SCOP Domain Coordinates for d1h1ta_:

Click to download the PDB-style file with coordinates for d1h1ta_.
(The format of our PDB-style files is described here.)

Timeline for d1h1ta_: