SCOP 1.65: Domain d1h1ob2: 1h1o B:294-383

Lineage for d1h1ob2 (1h1o B:294-383)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.4: Two-domain cytochrome c [46680] (2 proteins)
   duplication: consists of two cytochrome c type domains

6. Protein Cytochrome c4 [46681] (2 species)

7. Species Thiobacillus ferrooxidans [TaxId:920] [88972] (1 PDB entry)

8. Domain d1h1ob2: 1h1o B:294-383 [83457]
   complexed with gol, hem, so4, zn

Details for d1h1ob2

PDB Entry: 1h1o, 2.13 Å

PDB Description: acidithiobacillus ferrooxidans cytochrome c4 structure supports a complex-induced tuning of electron transfer

SCOP Domain Sequences for d1h1ob2:

Sequence; same for both SEQRES and ATOM records:

>d1h1ob2 a.3.1.4 (B:294-383) Cytochrome c4 {Thiobacillus ferrooxidans}
gikhagakegkaifnqgvtneqipacmechgsdgqgagpfprlagqrygyiiqqltyfhn
gtrvntlmnqiaknitvaqmkdvaaylssl

Timeline for d1h1ob2:

• d1h1ob2 is new in SCOP 1.65
  
• d1h1ob2 appears in SCOP 1.67
  
• d1h1ob2 appears in the current release, SCOPe 2.08