Lineage for d1h1da_ (1h1d A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399355Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 399356Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (38 families) (S)
  5. 399357Family c.66.1.1: Catechol O-methyltransferase, COMT [53336] (1 protein)
  6. 399358Protein Catechol O-methyltransferase, COMT [53337] (1 species)
  7. 399359Species Rat (Rattus norvegicus) [TaxId:10116] [53338] (3 PDB entries)
  8. 399360Domain d1h1da_: 1h1d A: [83452]
    complexed with bia, mg, sam

Details for d1h1da_

PDB Entry: 1h1d (more details), 2 Å

PDB Description: catechol o-methyltransferase

SCOP Domain Sequences for d1h1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1da_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus)}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgps

SCOP Domain Coordinates for d1h1da_:

Click to download the PDB-style file with coordinates for d1h1da_.
(The format of our PDB-style files is described here.)

Timeline for d1h1da_: