SCOPe 2.04: Domain d1h1ab_: 1h1a B:

Lineage for d1h1ab_ (1h1a B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (18 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Chaetomium thermophilum [TaxId:209285] [89272] (1 PDB entry)
   endoxylanase 11a

8. Domain d1h1ab_: 1h1a B: [83451]
   complexed with ca, gol, so4, unx

Details for d1h1ab_

PDB Entry: 1h1a, 1.75 Å

PDB Description: thermophilic beta-1,4-xylanase from chaetomium thermophilum

PDB Compounds: (B:) endoxylanase 11A

SCOPe Domain Sequences for d1h1ab_:

Sequence; same for both SEQRES and ATOM records:

>d1h1ab_ b.29.1.11 (B:) Xylanase II {Chaetomium thermophilum [TaxId: 209285]}
etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
yssgsatvnvg

Timeline for d1h1ab_:

• d1h1ab_ first appeared in SCOP 1.65
  
• d1h1ab_ appears in SCOPe 2.03
  
• d1h1ab_ appears in SCOPe 2.05
  
• d1h1ab_ appears in the current release, SCOPe 2.08