| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Chaetomium thermophilum [TaxId:209285] [89272] (1 PDB entry) endoxylanase 11a |
| Domain d1h1ab_: 1h1a B: [83451] complexed with ca, gol, so4, unx |
PDB Entry: 1h1a (more details), 1.75 Å
SCOPe Domain Sequences for d1h1ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1ab_ b.29.1.11 (B:) Xylanase II {Chaetomium thermophilum [TaxId: 209285]}
etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
yssgsatvnvg
Timeline for d1h1ab_: