Lineage for d1h1ab_ (1h1a B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780168Species Chaetomium thermophilum [TaxId:209285] [89272] (1 PDB entry)
    endoxylanase 11a
  8. 2780170Domain d1h1ab_: 1h1a B: [83451]
    complexed with ca, gol, so4, unx

Details for d1h1ab_

PDB Entry: 1h1a (more details), 1.75 Å

PDB Description: thermophilic beta-1,4-xylanase from chaetomium thermophilum
PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1h1ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1ab_ b.29.1.11 (B:) Xylanase II {Chaetomium thermophilum [TaxId: 209285]}
etltssatgthngyyysfwtdgqgnirfnlesggqysvtwsgngnwvggkgwnpgtdnrv
inytadyrpngnsylavygwtrnplieyyvvesfgtydpstgatrmgsvttdggtyniyr
tqrvnapsiegtktfyqywsvrtskrtggtvtmanhfnawrqaglqlgshdyqivategy
yssgsatvnvg

SCOPe Domain Coordinates for d1h1ab_:

Click to download the PDB-style file with coordinates for d1h1ab_.
(The format of our PDB-style files is described here.)

Timeline for d1h1ab_: