Lineage for d1h14a_ (1h14 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007006Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2007023Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2007044Protein Endo-1,4-beta-xylanase [89105] (1 species)
    cold-adapted family 8 xylanase
  7. 2007045Species Pseudoalteromonas haloplanktis [TaxId:228] [89106] (8 PDB entries)
  8. 2007049Domain d1h14a_: 1h14 A: [83449]

Details for d1h14a_

PDB Entry: 1h14 (more details), 1.5 Å

PDB Description: structure of a cold-adapted family 8 xylanase
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1h14a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h14a_ a.102.1.2 (A:) Endo-1,4-beta-xylanase {Pseudoalteromonas haloplanktis [TaxId: 228]}
afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
ahyikainpdegddirtegqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
vyawklklnqngfvykvdegpapngeeyfafallnasarwgnsgefnyyndaitmlntik
nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntf

SCOPe Domain Coordinates for d1h14a_:

Click to download the PDB-style file with coordinates for d1h14a_.
(The format of our PDB-style files is described here.)

Timeline for d1h14a_: