Lineage for d1h14a_ (1h14 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358916Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 358917Superfamily a.102.1: Six-hairpin glycosidases [48208] (6 families) (S)
  5. 358929Family a.102.1.2: Cellulases catalytic domain [48213] (8 proteins)
  6. 358942Protein Endo-1,4-beta-xylanase [89105] (1 species)
    cold-adapted family 8 xylanase
  7. 358943Species Pseudoalteromonas haloplanktis [89106] (3 PDB entries)
  8. 358946Domain d1h14a_: 1h14 A: [83449]
    mutant

Details for d1h14a_

PDB Entry: 1h14 (more details), 1.5 Å

PDB Description: structure of a cold-adapted family 8 xylanase

SCOP Domain Sequences for d1h14a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h14a_ a.102.1.2 (A:) Endo-1,4-beta-xylanase {Pseudoalteromonas haloplanktis}
afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
ahyikainpdegddirtegqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
vyawklklnqngfvykvdegpapngeeyfafallnasarwgnsgefnyyndaitmlntik
nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntf

SCOP Domain Coordinates for d1h14a_:

Click to download the PDB-style file with coordinates for d1h14a_.
(The format of our PDB-style files is described here.)

Timeline for d1h14a_: