Lineage for d1h14a_ (1h14 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284240Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (6 families) (S)
  5. 284252Family a.102.1.2: Cellulases catalytic domain [48213] (7 proteins)
  6. 284261Protein Endo-1,4-beta-xylanase [89105] (1 species)
    cold-adapted family 8 xylanase
  7. 284262Species Pseudoalteromonas haloplanktis [89106] (3 PDB entries)
  8. 284265Domain d1h14a_: 1h14 A: [83449]
    mutant

Details for d1h14a_

PDB Entry: 1h14 (more details), 1.5 Å

PDB Description: structure of a cold-adapted family 8 xylanase

SCOP Domain Sequences for d1h14a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h14a_ a.102.1.2 (A:) Endo-1,4-beta-xylanase {Pseudoalteromonas haloplanktis}
afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
ahyikainpdegddirtegqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
vyawklklnqngfvykvdegpapngeeyfafallnasarwgnsgefnyyndaitmlntik
nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntf

SCOP Domain Coordinates for d1h14a_:

Click to download the PDB-style file with coordinates for d1h14a_.
(The format of our PDB-style files is described here.)

Timeline for d1h14a_: