Lineage for d1h13a_ (1h13 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722054Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 2722075Protein Endo-1,4-beta-xylanase [89105] (1 species)
    cold-adapted family 8 xylanase
  7. 2722076Species Pseudoalteromonas haloplanktis [TaxId:228] [89106] (8 PDB entries)
  8. 2722079Domain d1h13a_: 1h13 A: [83448]

Details for d1h13a_

PDB Entry: 1h13 (more details), 1.3 Å

PDB Description: structure of a cold-adapted family 8 xylanase
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1h13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h13a_ a.102.1.2 (A:) Endo-1,4-beta-xylanase {Pseudoalteromonas haloplanktis [TaxId: 228]}
afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
ahyikainpdegddirtegqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
vyawklklnqngfvykvdegpapdgeeyfafallnasarwgnsgefnyyndaitmlntik
nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntf

SCOPe Domain Coordinates for d1h13a_:

Click to download the PDB-style file with coordinates for d1h13a_.
(The format of our PDB-style files is described here.)

Timeline for d1h13a_: