Lineage for d1h12a_ (1h12 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774163Superfamily a.102.1: Six-hairpin glycosidases [48208] (9 families) (S)
  5. 774177Family a.102.1.2: Cellulases catalytic domain [48213] (11 proteins)
  6. 774195Protein Endo-1,4-beta-xylanase [89105] (1 species)
    cold-adapted family 8 xylanase
  7. 774196Species Pseudoalteromonas haloplanktis [TaxId:228] [89106] (8 PDB entries)
  8. 774197Domain d1h12a_: 1h12 A: [83447]
    complexed with xyp, xys

Details for d1h12a_

PDB Entry: 1h12 (more details), 1.2 Å

PDB Description: structure of a cold-adapted family 8 xylanase
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOP Domain Sequences for d1h12a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h12a_ a.102.1.2 (A:) Endo-1,4-beta-xylanase {Pseudoalteromonas haloplanktis [TaxId: 228]}
afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
ahyikainpdegddirtegqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
vyawklklnqngfvykvdegpapdgeeyfafallnasarwgnsgefnyyndaitmlntik
nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntf

SCOP Domain Coordinates for d1h12a_:

Click to download the PDB-style file with coordinates for d1h12a_.
(The format of our PDB-style files is described here.)

Timeline for d1h12a_: