Lineage for d1h10a_ (1h10 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300574Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 300575Superfamily b.55.1: PH domain-like [50729] (6 families) (S)
  5. 300576Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (15 proteins)
  6. 300640Protein Rac-alpha serine/threonine kinase [89355] (1 species)
  7. 300641Species Human (Homo sapiens) [TaxId:9606] [89356] (1 PDB entry)
  8. 300642Domain d1h10a_: 1h10 A: [83446]
    complexed with ace, its, mse

Details for d1h10a_

PDB Entry: 1h10 (more details), 1.4 Å

PDB Description: high resolution structure of the pleckstrin homology domain of protein kinase b/akt bound to ins(1,3,4,5)-tetrakisphophate

SCOP Domain Sequences for d1h10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h10a_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens)}
smsdvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeee

SCOP Domain Coordinates for d1h10a_:

Click to download the PDB-style file with coordinates for d1h10a_.
(The format of our PDB-style files is described here.)

Timeline for d1h10a_: