Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Rac-alpha serine/threonine kinase [89355] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89356] (4 PDB entries) Uniprot P31749 1-117 |
Domain d1h10a_: 1h10 A: [83446] complexed with 4ip |
PDB Entry: 1h10 (more details), 1.4 Å
SCOPe Domain Sequences for d1h10a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h10a_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} smsdvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeee
Timeline for d1h10a_: