SCOP 1.71: Domain d1h0kb1: 1h0k B:23-160,B:350-386

Lineage for d1h0kb1 (1h0k B:23-160,B:350-386)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein 2,4-dienoyl-CoA reductase [89309] (1 species)

7. Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (5 PDB entries)

8. Domain d1h0kb1: 1h0k B:23-160,B:350-386 [83437]
   Other proteins in same PDB: d1h0ka2, d1h0kb2
   complexed with gol, so4

Details for d1h0kb1

PDB Entry: 1h0k, 2.11 Å

PDB Description: enoyl thioester reductase 2

SCOP Domain Sequences for d1h0kb1:

Sequence; same for both SEQRES and ATOM records:

>d1h0kb1 b.35.1.2 (B:23-160,B:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis)}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

Timeline for d1h0kb1:

• d1h0kb1 first appeared in SCOP 1.65
  
• d1h0kb1 appears in SCOP 1.69
  
• d1h0kb1 appears in SCOP 1.73
  
• d1h0kb1 appears in the current release, SCOPe 2.08