Lineage for d1h0kb1 (1h0k B:23-160,B:350-386)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373088Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 373089Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 373153Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 373154Protein 2,4-dienoyl-CoA reductase [89309] (1 species)
  7. 373155Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (5 PDB entries)
  8. 373159Domain d1h0kb1: 1h0k B:23-160,B:350-386 [83437]
    Other proteins in same PDB: d1h0ka2, d1h0kb2
    complexed with gol, so4

Details for d1h0kb1

PDB Entry: 1h0k (more details), 2.11 Å

PDB Description: enoyl thioester reductase 2

SCOP Domain Sequences for d1h0kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0kb1 b.35.1.2 (B:23-160,B:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis)}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

SCOP Domain Coordinates for d1h0kb1:

Click to download the PDB-style file with coordinates for d1h0kb1.
(The format of our PDB-style files is described here.)

Timeline for d1h0kb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h0kb2