Lineage for d1h0ja_ (1h0j A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 342525Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulphide-rich fold: nearly all-beta
  4. 342526Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 342527Family g.7.1.1: Snake venom toxins [57303] (23 proteins)
  6. 342592Protein Cardiotoxin III [57337] (1 species)
  7. 342593Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57338] (4 PDB entries)
  8. 342594Domain d1h0ja_: 1h0j A: [83432]

Details for d1h0ja_

PDB Entry: 1h0j (more details), 1.9 Å

PDB Description: structural basis of the membrane-induced cardiotoxin a3 oligomerization

SCOP Domain Sequences for d1h0ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ja_ g.7.1.1 (A:) Cardiotoxin III {Taiwan cobra (Naja naja atra)}
lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn

SCOP Domain Coordinates for d1h0ja_:

Click to download the PDB-style file with coordinates for d1h0ja_.
(The format of our PDB-style files is described here.)

Timeline for d1h0ja_: