Lineage for d1h0dc_ (1h0d C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715752Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 715753Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 715754Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 715773Protein Angiogenin [54094] (2 species)
  7. 715777Species Human (Homo sapiens) [TaxId:9606] [54095] (19 PDB entries)
  8. 715782Domain d1h0dc_: 1h0d C: [83429]
    Other proteins in same PDB: d1h0da1, d1h0da2, d1h0db1, d1h0db2
    complexed with gol, pca, so4

Details for d1h0dc_

PDB Entry: 1h0d (more details), 2 Å

PDB Description: crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f
PDB Compounds: (C:) angiogenin

SCOP Domain Sequences for d1h0dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0dc_ d.5.1.1 (C:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
rrp

SCOP Domain Coordinates for d1h0dc_:

Click to download the PDB-style file with coordinates for d1h0dc_.
(The format of our PDB-style files is described here.)

Timeline for d1h0dc_: