Lineage for d1h0db2 (1h0d B:114-215)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453496Domain d1h0db2: 1h0d B:114-215 [83428]
    Other proteins in same PDB: d1h0da1, d1h0da2, d1h0db1, d1h0dc_
    part of anti-angiogenin FAB; conflict: annotated in PDB as human

Details for d1h0db2

PDB Entry: 1h0d (more details), 2 Å

PDB Description: crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f

SCOP Domain Sequences for d1h0db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0db2 b.1.1.2 (B:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgggggggamvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsspwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1h0db2:

Click to download the PDB-style file with coordinates for d1h0db2.
(The format of our PDB-style files is described here.)

Timeline for d1h0db2: