SCOP 1.65: Domain d1h0db2: 1h0d B:114-215

Lineage for d1h0db2 (1h0d B:114-215)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d1h0db2: 1h0d B:114-215 [83428]
   Other proteins in same PDB: d1h0da1, d1h0da2, d1h0db1, d1h0dc_
   part of anti-angiogenin FAB; conflict: annotated in PDB as human
   complexed with gol, pca, so4

Details for d1h0db2

PDB Entry: 1h0d, 2 Å

PDB Description: crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f

SCOP Domain Sequences for d1h0db2:

Sequence; same for both SEQRES and ATOM records:

>d1h0db2 b.1.1.2 (B:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgggggggamvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsspwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1h0db2:

• d1h0db2 is new in SCOP 1.65
  
• d1h0db2 appears in SCOP 1.67
  
• d1h0db2 appears in the current release, SCOPe 2.08