SCOPe 2.04: Domain d1h0db1: 1h0d B:1-113

Lineage for d1h0db1 (1h0d B:1-113)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1h0db1: 1h0d B:1-113 [83427]
   Other proteins in same PDB: d1h0da1, d1h0da2, d1h0db2, d1h0dc_
   part of anti-angiogenin FAB; conflict: annotated in PDB as human
   complexed with gol, so4

Details for d1h0db1

PDB Entry: 1h0d, 2 Å

PDB Description: crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f

PDB Compounds: (B:) antibody fab fragment, heavy chain

SCOPe Domain Sequences for d1h0db1:

Sequence; same for both SEQRES and ATOM records:

>d1h0db1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evmlvesggglvkpggslklscaasgftfssytmswvrqtpekrlewvatissgggntyy
pdsvkgrftisrdiakntlylqmsslrsedtalyyctrlgdygyaytmdywgqgtsvtvs
s

Timeline for d1h0db1:

• d1h0db1 first appeared in SCOP 1.65
  
• d1h0db1 appears in SCOPe 2.03
  
• d1h0db1 appears in SCOPe 2.05
  
• d1h0db1 appears in the current release, SCOPe 2.08