Lineage for d1h0da2 (1h0d A:107-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656225Domain d1h0da2: 1h0d A:107-211 [83426]
    Other proteins in same PDB: d1h0da1, d1h0db1, d1h0db2, d1h0dc_
    part of anti-angiogenin FAB; conflict: annotated in PDB as human
    complexed with gol, pca, so4

Details for d1h0da2

PDB Entry: 1h0d (more details), 2 Å

PDB Description: crystal structure of human angiogenin in complex with fab fragment of its monoclonal antibody mab 26-2f
PDB Compounds: (A:) antibody fab fragment, light chain

SCOP Domain Sequences for d1h0da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0da2 b.1.1.2 (A:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathaaspivksfnrnec

SCOP Domain Coordinates for d1h0da2:

Click to download the PDB-style file with coordinates for d1h0da2.
(The format of our PDB-style files is described here.)

Timeline for d1h0da2: