SCOP 1.73: Domain d1h0bb_: 1h0b B:

Lineage for d1h0bb_ (1h0b B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)

7. Species Rhodothermus marinus [TaxId:29549] [89275] (4 PDB entries)

8. Domain d1h0bb_: 1h0b B: [83423]
   complexed with epe

Details for d1h0bb_

PDB Entry: 1h0b, 1.8 Å

PDB Description: endoglucanase cel12a from rhodothermus marinus

PDB Compounds: (B:) cellulase

SCOP Domain Sequences for d1h0bb_:

Sequence; same for both SEQRES and ATOM records:

>d1h0bb_ b.29.1.11 (B:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus [TaxId: 29549]}
tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkla

Timeline for d1h0bb_:

• d1h0bb_ first appeared in SCOP 1.65
  
• d1h0bb_ appears in SCOP 1.71
  
• d1h0bb_ appears in SCOP 1.75
  
• d1h0bb_ appears in the current release, SCOPe 2.08