Lineage for d1h0bb_ (1h0b B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780056Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 2780071Species Rhodothermus marinus [TaxId:29549] [89275] (4 PDB entries)
  8. 2780073Domain d1h0bb_: 1h0b B: [83423]
    complexed with epe

Details for d1h0bb_

PDB Entry: 1h0b (more details), 1.8 Å

PDB Description: endoglucanase cel12a from rhodothermus marinus
PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d1h0bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0bb_ b.29.1.11 (B:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus [TaxId: 29549]}
tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkla

SCOPe Domain Coordinates for d1h0bb_:

Click to download the PDB-style file with coordinates for d1h0bb_.
(The format of our PDB-style files is described here.)

Timeline for d1h0bb_: