Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species) |
Species Rhodothermus marinus [TaxId:29549] [89275] (4 PDB entries) |
Domain d1h0bb_: 1h0b B: [83423] complexed with epe |
PDB Entry: 1h0b (more details), 1.8 Å
SCOPe Domain Sequences for d1h0bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0bb_ b.29.1.11 (B:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Rhodothermus marinus [TaxId: 29549]} tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkla
Timeline for d1h0bb_: