SCOPe 2.06: Domain d1h09a1: 1h09 A:191-339

Lineage for d1h09a1 (1h09 A:191-339)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.109: beta-hairpin stack [69359] (1 superfamily)
   Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn

4. Superfamily b.109.1: Cell wall binding repeat [69360] (1 family)

5. Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins)
   this is a repeat family; one repeat unit is 2bib A:415-315 found in domain

6. Protein C-terminal domain of endolysin [89422] (1 species)
7. Species Bacteriophage cp-1 [TaxId:10747] [89423] (2 PDB entries)

8. Domain d1h09a1: 1h09 A:191-339 [83420]
   Other proteins in same PDB: d1h09a2

Details for d1h09a1

PDB Entry: 1h09, 2.1 Å

PDB Description: multimodular pneumococcal cell wall endolysin from phage cp-1

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1h09a1:

Sequence; same for both SEQRES and ATOM records:

>d1h09a1 b.109.1.1 (A:191-339) C-terminal domain of endolysin {Bacteriophage cp-1 [TaxId: 10747]}
eeddkpktagtwkqdskgwwfrrnngsfpynkwekiggvwyyfdskgycltsewlkdnek
wyylkdngamatgwvlvgsewyymddsgamvtgwvkyknnwyymtnergnmvsnefiksg
kgwyfmntngeladnpsftkepdglitva

Timeline for d1h09a1:

• d1h09a1 first appeared in SCOP 1.65
  
• d1h09a1 appears in SCOPe 2.05
  
• d1h09a1 appears in SCOPe 2.07
  
• d1h09a1 appears in the current release, SCOPe 2.08