SCOPe 2.07: Domain d1h04p2: 1h04 P:67-129

Lineage for d1h04p2 (1h04 P:67-129)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)

8. Domain d1h04p2: 1h04 P:67-129 [83416]
   modules 3 and 4
   complexed with ni

Details for d1h04p2

PDB Entry: 1h04, 2 Å

PDB Description: human cd55 domains 3 & 4

PDB Compounds: (P:) complement decay-accelerating factor

SCOPe Domain Sequences for d1h04p2:

Sequence; same for both SEQRES and ATOM records:

>d1h04p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndagewsgpppe
crg

Timeline for d1h04p2:

• d1h04p2 first appeared in SCOP 1.65
  
• d1h04p2 appears in SCOPe 2.06
  
• d1h04p2 appears in the current release, SCOPe 2.08