Lineage for d1gz7d_ (1gz7 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135098Family c.69.1.17: Fungal lipases [53558] (5 protein domains)
  6. 2135196Protein Type-B carboxylesterase/lipase [53566] (4 species)
  7. 2135202Species Candida rugosa, lipase 2 isoform [TaxId:5481] [89774] (1 PDB entry)
  8. 2135206Domain d1gz7d_: 1gz7 D: [83404]
    complexed with gol

Details for d1gz7d_

PDB Entry: 1gz7 (more details), 1.97 Å

PDB Description: crystal structure of the closed state of lipase 2 from candida rugosa
PDB Compounds: (D:) lipase 2

SCOPe Domain Sequences for d1gz7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gz7d_ c.69.1.17 (D:) Type-B carboxylesterase/lipase {Candida rugosa, lipase 2 isoform [TaxId: 5481]}
aptatlangdtitglnaivnekflgipfaeppvgtlrfkppvpysaslngqqftsygpsc
mqmnpmgsfedtlpknaldlvlqskifqvvlpndedcltinvirppgtrasaglpvmlwi
fgggfelggsslfpgdqmvaksvlmgkpvihvsmnyrvaswgflagpdiqnegsgnaglh
dqrlamqwvadniagfggdpskvtiygesagsmstfvhlvwndgdntyngkplfraaimq
sgcmvpsdpvdgtygteiynqvvasagcgsasdklaclrglsqdtlyqatsdtpgvlayp
slrlsylprpdgtfitddmyalvrdgkyahvpviigdqndegtlfglsslnvttdaqara
yfkqsfihasdaeidtlmaaytsditqgspfdtgifnaitpqfkrisallgdlaftlarr
yflnyyqggtkysflskqlsglpvlgtfhgndiiwqdylvgsgsviynnafiafandldp
nkaglwtnwptytsssqsgnnlmqinglglytgkdnfrpdaysalfsnppsffv

SCOPe Domain Coordinates for d1gz7d_:

Click to download the PDB-style file with coordinates for d1gz7d_.
(The format of our PDB-style files is described here.)

Timeline for d1gz7d_: