Lineage for d1gz3c2 (1gz3 C:20-279)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890498Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
    Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 2890505Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 2890523Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)
  8. 2890552Domain d1gz3c2: 1gz3 C:20-279 [83398]
    Other proteins in same PDB: d1gz3a1, d1gz3b1, d1gz3c1, d1gz3d1
    complexed with atp, fum, mn, oxl

Details for d1gz3c2

PDB Entry: 1gz3 (more details), 2.3 Å

PDB Description: molecular mechanism for the regulation of human mitochondrial nad(p)+- dependent malic enzyme by atp and fumarate
PDB Compounds: (C:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d1gz3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gz3c2 c.58.1.3 (C:20-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
hikekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspl
ekyiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisd
rghvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdqcl
pvcidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgn
hnafrflrkyrekyctfndd

SCOPe Domain Coordinates for d1gz3c2:

Click to download the PDB-style file with coordinates for d1gz3c2.
(The format of our PDB-style files is described here.)

Timeline for d1gz3c2: