Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (21 proteins) |
Protein Ovocleidin-17 [90059] (1 species) major protein of the eggshell calcified layer |
Species Chicken (Gallus gallus) [TaxId:9031] [90060] (1 PDB entry) |
Domain d1gz2a_: 1gz2 A: [83392] complexed with sep |
PDB Entry: 1gz2 (more details), 1.5 Å
SCOP Domain Sequences for d1gz2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gz2a_ d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gallus)} gcgpgwvptpggclgffsrelswsraesfcrrwgpgshlaavrsaaelrllaellnasrg gdgsgegadgrvwiglhrpagsrswrwsdgtaprfaswhrtakarrggrcaalrdeeaft swaarpcternafvckaaa
Timeline for d1gz2a_: