Lineage for d1gz2a_ (1gz2 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336759Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 336760Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 336761Family d.169.1.1: C-type lectin domain [56437] (21 proteins)
  6. 336962Protein Ovocleidin-17 [90059] (1 species)
    major protein of the eggshell calcified layer
  7. 336963Species Chicken (Gallus gallus) [TaxId:9031] [90060] (1 PDB entry)
  8. 336964Domain d1gz2a_: 1gz2 A: [83392]
    complexed with sep

Details for d1gz2a_

PDB Entry: 1gz2 (more details), 1.5 Å

PDB Description: crystal structure of the ovocleidin-17 a major protein of the gallus gallus eggshell calcified layer.

SCOP Domain Sequences for d1gz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gz2a_ d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gallus)}
gcgpgwvptpggclgffsrelswsraesfcrrwgpgshlaavrsaaelrllaellnasrg
gdgsgegadgrvwiglhrpagsrswrwsdgtaprfaswhrtakarrggrcaalrdeeaft
swaarpcternafvckaaa

SCOP Domain Coordinates for d1gz2a_:

Click to download the PDB-style file with coordinates for d1gz2a_.
(The format of our PDB-style files is described here.)

Timeline for d1gz2a_: