Lineage for d1gyrc2 (1gyr C:161-349)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574153Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 574154Protein 2,4-dienoyl-CoA reductase [89517] (1 species)
  7. 574155Species Yeast (Candida tropicalis) [TaxId:5482] [89518] (5 PDB entries)
  8. 574168Domain d1gyrc2: 1gyr C:161-349 [83391]
    Other proteins in same PDB: d1gyra1, d1gyrb1, d1gyrc1
    complexed with gol, so4; mutant

Details for d1gyrc2

PDB Entry: 1gyr (more details), 2.6 Å

PDB Description: mutant form of enoyl thioester reductase from candida tropicalis

SCOP Domain Sequences for d1gyrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyrc2 c.2.1.1 (C:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis)}
ltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisv
irdrpnldevvaslkelgatqvitedqnnsrefgptikewikqsggeaklalncvggkss
tgiarklnnnglmltyggmsfqpvtiptslyifknftsagfwvtellknnkelktstlnq
iiawyeegk

SCOP Domain Coordinates for d1gyrc2:

Click to download the PDB-style file with coordinates for d1gyrc2.
(The format of our PDB-style files is described here.)

Timeline for d1gyrc2: