![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (8 proteins) N-terminal all-beta domain defines family |
![]() | Protein 2,4-dienoyl-CoA reductase [89517] (1 species) |
![]() | Species Yeast (Candida tropicalis) [TaxId:5482] [89518] (4 PDB entries) |
![]() | Domain d1gyrc2: 1gyr C:161-349 [83391] Other proteins in same PDB: d1gyra1, d1gyrb1, d1gyrc1 complexed with gol, so4; mutant |
PDB Entry: 1gyr (more details), 2.6 Å
SCOP Domain Sequences for d1gyrc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyrc2 c.2.1.1 (C:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis)} ltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisv irdrpnldevvaslkelgatqvitedqnnsrefgptikewikqsggeaklalncvggkss tgiarklnnnglmltyggmsfqpvtiptslyifknftsagfwvtellknnkelktstlnq iiawyeegk
Timeline for d1gyrc2:
![]() Domains from other chains: (mouse over for more information) d1gyra1, d1gyra2, d1gyrb1, d1gyrb2 |