![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (2 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein 2,4-dienoyl-CoA reductase [89309] (1 species) |
![]() | Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (5 PDB entries) |
![]() | Domain d1gyrc1: 1gyr C:23-160,C:350-386 [83390] Other proteins in same PDB: d1gyra2, d1gyrb2, d1gyrc2 complexed with gol, so4; mutant |
PDB Entry: 1gyr (more details), 2.6 Å
SCOP Domain Sequences for d1gyrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyrc1 b.35.1.2 (C:23-160,C:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis)} mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvnpsk pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity
Timeline for d1gyrc1:
![]() Domains from other chains: (mouse over for more information) d1gyra1, d1gyra2, d1gyrb1, d1gyrb2 |