SCOP 1.69: Domain d1gyke_: 1gyk E:

Lineage for d1gyke_ (1gyk E:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)

6. Protein Serum amyloid P component (SAP) [49952] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49953] (3 PDB entries)

8. Domain d1gyke_: 1gyk E: [83384]

Details for d1gyke_

PDB Entry: 1gyk, 2.2 Å

PDB Description: serum amyloid p component co-crystallised with mobdg at neutral ph

SCOP Domain Sequences for d1gyke_:

Sequence; same for both SEQRES and ATOM records:

>d1gyke_ b.29.1.5 (E:) Serum amyloid P component (SAP) {Human (Homo sapiens)}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

Timeline for d1gyke_:

• d1gyke_ first appeared in SCOP 1.65
  
• d1gyke_ appears in SCOP 1.67
  
• d1gyke_ appears in SCOP 1.71
  
• d1gyke_ appears in the current release, SCOPe 2.08