Lineage for d1gykd_ (1gyk D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556441Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 556469Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 556470Species Human (Homo sapiens) [TaxId:9606] [49953] (3 PDB entries)
  8. 556479Domain d1gykd_: 1gyk D: [83383]

Details for d1gykd_

PDB Entry: 1gyk (more details), 2.2 Å

PDB Description: serum amyloid p component co-crystallised with mobdg at neutral ph

SCOP Domain Sequences for d1gykd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gykd_ b.29.1.5 (D:) Serum amyloid P component (SAP) {Human (Homo sapiens)}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOP Domain Coordinates for d1gykd_:

Click to download the PDB-style file with coordinates for d1gykd_.
(The format of our PDB-style files is described here.)

Timeline for d1gykd_: