Lineage for d1gykc_ (1gyk C:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794846Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 794874Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 794875Species Human (Homo sapiens) [TaxId:9606] [49953] (6 PDB entries)
  8. 794888Domain d1gykc_: 1gyk C: [83382]

Details for d1gykc_

PDB Entry: 1gyk (more details), 2.2 Å

PDB Description: serum amyloid p component co-crystallised with mobdg at neutral ph
PDB Compounds: (C:) serum amyloid p-component

SCOP Domain Sequences for d1gykc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gykc_ b.29.1.5 (C:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOP Domain Coordinates for d1gykc_:

Click to download the PDB-style file with coordinates for d1gykc_.
(The format of our PDB-style files is described here.)

Timeline for d1gykc_: