Lineage for d1gykb_ (1gyk B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663880Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 663908Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 663909Species Human (Homo sapiens) [TaxId:9606] [49953] (6 PDB entries)
  8. 663921Domain d1gykb_: 1gyk B: [83381]

Details for d1gykb_

PDB Entry: 1gyk (more details), 2.2 Å

PDB Description: serum amyloid p component co-crystallised with mobdg at neutral ph
PDB Compounds: (B:) serum amyloid p-component

SCOP Domain Sequences for d1gykb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gykb_ b.29.1.5 (B:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOP Domain Coordinates for d1gykb_:

Click to download the PDB-style file with coordinates for d1gykb_.
(The format of our PDB-style files is described here.)

Timeline for d1gykb_: