Lineage for d1gykb_ (1gyk B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371692Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 371720Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 371721Species Human (Homo sapiens) [TaxId:9606] [49953] (3 PDB entries)
  8. 371728Domain d1gykb_: 1gyk B: [83381]

Details for d1gykb_

PDB Entry: 1gyk (more details), 2.2 Å

PDB Description: serum amyloid p component co-crystallised with mobdg at neutral ph

SCOP Domain Sequences for d1gykb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gykb_ b.29.1.5 (B:) Serum amyloid P component (SAP) {Human (Homo sapiens)}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOP Domain Coordinates for d1gykb_:

Click to download the PDB-style file with coordinates for d1gykb_.
(The format of our PDB-style files is described here.)

Timeline for d1gykb_: